PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn243421
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family G2-like
Protein Properties Length: 342aa    MW: 39457.7 Da    PI: 5.7594
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn243421genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.98.4e-3278131255
     G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 prlrWtp+LH rFv+ave+LGG+++AtPk +l+lm++kgL ++hvkSHLQ+YR+
  Achn243421  78 PRLRWTPDLHLRFVHAVERLGGQDRATPKLVLQLMNMKGLNISHVKSHLQMYRS 131
                 8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.78974134IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.8E-3074132IPR009057Homeodomain-like
SuperFamilySSF466891.61E-1476132IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-2278133IPR006447Myb domain, plants
PfamPF002491.2E-879130IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MEGNGSSECS KVSPLSDQKE EEEEEEEEEE EEEEEEEEEE EEANNTCKAK DGAISSNSMV  60
EESERKSLVR PYVRSKMPRL RWTPDLHLRF VHAVERLGGQ DRATPKLVLQ LMNMKGLNIS  120
HVKSHLQMYR SKKIDDASQV LADHRHLVEG GDRNIFNLSQ LPMLQGFNQR HHSSFRYGNA  180
SWSSHENWMH IPFISQSRID NERSGFYGTF HERFFGSRYS NLVNEQSTWR NNEPKEEFRS  240
IHDSLNAQVL QPKERANLSN IPHGLNMRMN VEERIAVKRK ASDWDLDLNL SLGVKQKIED  300
HDNNNLSLCL YLGSSSKISR LKKGDSEENG RRKASTLDLT M*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00297DAPTransfer from AT2G38300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002268055.11e-106PREDICTED: putative Myb family transcription factor At1g14600
TrEMBLA5AMV61e-106A5AMV6_VITVI; Putative uncharacterized protein
STRINGPOPTR_0016s12940.16e-91(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA43822141
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.17e-66G2-like family protein